Case of spontaneous tubal stump pregnancy after adnexectomy
Publication date: Available online 8 January 2016 Source:Journal of Acute Disease Author(s): Konrad Futyma, Andrzej Wróbel, Aleksandra Filipczak, Tomasz Rechberger Ectopic pregnancy is a significant problem in women of childbearing potential and affects up to 2% of them. The most common ectopic pregnancy localization is the ampullary area of the Fallopian tube. Patient with spontaneous ectopic pregnancy located in the tubal stump after an ipsilateral adnexectomy performed with a laparotomy due to mucinous cystadenoma was operated by laparoscopy. Remnant of Fallopian tube with ectopic pregnancy was removed. The...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
A case of acute periorbital necrotizing fasciitis
In this report, we present a rare case of periorbital necrotizing fasciitis caused by Aspergillus species in an immunocompromised patient. He presented to us with a history of a slowly progressive eyelid necrosis leading to a loss of vision in one eye. The patient was started on an antibiotic and subsequently, surgical debridement and enucleation were performed. A few days post-operatively, yellow white mould colonies were noted to grow on the wound surface. Microbiology cultures identified them as Aspergillus species and intravenous amphotericin B 10 mg was added daily. However, despite the extensive medical and surgical ...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
The effects of acute gasoline vapour inhalation on some haematological indices of albino Wistar rats
Conclusions The results obtained suggest that inhalation exposure to gasoline may result in pancytopaenia and a significant fluctuation in the RBC dependent haematological indices. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Acute drug allergy after getting medical treatment from a primary care unit: Comment and discussion
Publication date: Available online 8 January 2016 Source:Journal of Acute Disease Author(s): Beuy Joob, Viroj Wiwanitkit (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Evolving brain lesions in the follow-up CT scans 12 hours after traumatic brain injury
Conclusions In case where the initial CT scan performed within 4 h of significant head injury was not correlated with the patient’s neurology, it should be repeated within 12 h. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Clinical presentation, diagnosis and management of acute mitral regurgitation following acute myocardial infarction
Publication date: Available online 8 January 2016 Source:Journal of Acute Disease Author(s): Rengin Çetin Güvenç, Tolga Sinan Güvenç Acute mitral regurgitation (MR) is a frequent complication of acute myocardial infarction, with a variable presentation depending on the severity of MR and the integrity of the subvalvular apparatus. While most cases are asymptomatic or have mild dyspnea, rupture of chordae tendinea or papillary muscles are catastrophic complications that may rapidly lead to cardiogenic shock and death. Despite the presence of pulmonary oedema and/or cardiogrenic shock, the murmur of acute MR is ...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Epidemiological patterns of animal bites in the Babol County, North of Iran
Conclusions Since the average age of the subjects with injuries on the head and upper organs was lower than that of victims with other organs injured and since that pet dogs were the major biter, structured monitoring programs that focus on specified target groups in collaboration with other organizations are essential to control the animal bites. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
A review on dronedarone: Pharmacological, pharmacodynamic and pharmacokinetic profile
This article briefly highlights the important pharmacological, pharmacodynamic and pharmacokinetic properties of dronedarone. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Investigation of obstacles against effective crisis management in earthquake
In this study, domestic journals, foreign dissertations in Persian bases Google scholar, Magiran, IranMedex, SID and English PubMed, Web of Science, Google scholar were used. The results of this study showed that there were many problems in various aspects of planning including: lack of coherent programs, lack of attention to the needs of health care, poor coordination between agencies and organizations and lack of appropriate training of volunteers and people. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Laboratory risk indicators for acute necrotizing fasciitis in the emergency setting
Publication date: Available online 8 January 2016 Source:Journal of Acute Disease Author(s): Syed Shayan Ali, Fatimah Lateef Necrotizing fasciitis is a rare bacterial skin condition which forms a major diagnostic challenge and is associated with poor prognosis unless promptly treated. Initial clinical presentation is often misleading with characteristic features developing only late in the course of the disease. In this review, we discuss the applicability and usefulness of laboratory risk indicator for necrotizing fasciitis score in facilitating rapid diagnosis of necrotizing fasciitis in emergency department by d...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Ventriculostomy related infection in intensive care unit: Dianostic criteria and related conditions
Conclusions CSF routine cultures and biochemical studies are not recommended to diagnose VRI. Clinical signs, external ventricular drain manipulation and a drainage insertion over a week justify the routine measurement of proteinorrachia, glycorrachia and the ratio of glycorrachia/glycemia. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Immunological study on integrated PilQ and disulphide loop region of PilA against acute Pseudomonas aeruginosa infection: In silico analysis and in vitro production
Conclusions We expect that the two recognized antigenic determinants from our chimeric protein, ‘‘AYHKGNWSGYGKDGNIGIKDEDGMNCGPIAGSCTFPTTGTSKSPSPFVDLGAKDATSG’’ and ‘‘GPIAGSCTFPTTGTSKSPSP’’, can be able to evoke strong both humoral and cell-mediated immune responses in mouse models. (Source: Journal of Acute Disease)
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Use of sodium polystyrene sulfonate in an acute-on-chronic lithium poisoned patient: A case report
Publication date: Available online 8 January 2016 Source:Journal of Acute Disease Author(s): Chakroun-Walha Olfa, Ksibi Hichem, Rejeb Imen, Boujelben Mariem, Chaari Adel, Chtara Kamilia, Bouaziz Mounir, Rekik Noureddine A 35-year-old woman with an acute-on-chronic lithium overdose received multiple oral doses of sodium polystyrene sulfonate totaling 120 g over a 24-h period. During the 72 h after the institution of therapy, the serum lithium level decreased from 3.80 to 0.42 mEq/L. Multiple doses of sodium polystyrene sulfonate may be useful in lowering the serum lithium level in severely ill patients w...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
A case report of thyroid storm induced by acute sepsis
We reported a 40-year-old woman with thyroid goiter manifesting with acute sepsis-induced hyperthyroidism. She mainly presented with abdominal bloating, diarrhea, lower limbs edema and exertional dyspnea. The lactate was 9.5 mmol/L and procalcitonin was 3.8 ng/mL, suggesting acute sepsis. The thyroid echo showed bilateral thyroid goiter. Relevant data included a thyroid-stimulating hormone level of 0.03 μIU/mL; free tetraiodothyronine, 5.67 ng/dL; thyroid-stimulating hormone receptor antibody, 76.9% (normal range, < 14%); and antimicrosomal antibody titer, 1:102 400 (normal range, < 1:100), suggesting toxic ...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
Challenges in uncomplicated acute appendicitis
Publication date: Available online 8 January 2016 Source:Journal of Acute Disease Author(s): Fernando Resende, Ana Beatriz Almeida, José Costa Maia, Renato Bessa Melo Acute appendicitis is one of the most common abdominal emergencies requiring surgery. It still represents, however, a challenging diagnosis. In order to facilitate this process, several scoring systems were developed, namely, the Alvarado score, acute inflammatory response and Raja Isteri Pengiran Anak Saleha Appendicitis scores, which are the most used in clinical practice. This clinical condition encompasses a wide spectrum of clinical presenta...
Source: Journal of Acute Disease - January 9, 2016 Category: Emergency Medicine Source Type: research
