Amyloid precursor protein is a restriction factor that protects against Zika virus infection in mammalian brains [Gene Regulation]
Zika virus (ZIKV) is a neurotropic flavivirus that causes several diseases including birth defects such as microcephaly. Intrinsic immunity is known to be a frontline defense against viruses through host anti-viral restriction factors. Limited knowledge is available on intrinsic immunity against ZIKV in brains. Amyloid precursor protein (APP) is predominantly expressed in brains and implicated in the pathogenesis of Alzheimer's diseases. We have found that ZIKV interacts with APP, and viral infection increases APP expression via enhancing protein stability. Moreover, we identified the viral peptide, HGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGL, which is capable of en-hancing APP expression. We observed that aging brain tissues with APP had protective effects on ZIKV infection by reducing the availability of the viruses. Also, knockdown of APP expression or blocking ZIKV-APP interactions enhanced ZIKV replication in human neural progenitor/stem cells. Finally, intracranial infection of ZIKV in APP-null neonatal mice resulted in higher mortality and viral yields. Taken together, these findings suggest that APP is a restriction factor that protects against ZIKV by serving as a decoy receptor, and plays a protective role in ZIKV-mediated brain injuries.
Source: Journal of Biological Chemistry - Category: Chemistry Authors: Amy Lingel, Haishuang Lin, Yuval Gavriel, Eric Weaver, Pascal Polepole, Virginia Lopez, Yuguo Lei, Thomas M. Petro, Beka Solomon, Chi Zhang, Luwen Zhang Tags: Microbiology Source Type: research
More News: Alzheimer's | Brain | Chemistry | Genetics | Microbiology | Neurology | Perinatology & Neonatology | Stem Cell Therapy | Stem Cells | Zika Virus